Structure of PDB 6tyi Chain C

Receptor sequence

>6tyiC (length=226) Species: 83333 (Escherichia coli K-12)

DLSVWGMYQHADIVVKCVMIGLILASVVTWAIFFSKSVEFFNQKRRLKRE
QQLLAEARSLNQANDIAADFGSKSLSLHLLNEAQNELELSEGSDDNEGIK
ERTSFRLERRVAAVGRQMGRGNGYLATIGAISPFVGLFGTVWGIMNSFIG
IAQTQTTNLAVVAPGIAEALLATAIGLVAAIPAVVIYNVFARQIGGFKAM
LGDVAAQVLLLQSRDLDLEASAAAHP

3D structure

• PDB: 6tyi Cryo-EM structure of the bacterial Ton motor subcomplex ExbB-ExbD provides information on structure and stoichiometry.
• Chain: C
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	A134 G137 F142 L145 I152 F156 L167 I174 Y195	A126 G129 F134 L137 I144 F148 L159 I166 Y187

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0022857 transmembrane transporter activity
• GO:0031992 energy transducer activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006879 intracellular iron ion homeostasis
• GO:0015031 protein transport
• GO:0015889 cobalamin transport
• GO:0017038 protein import
• GO:0030003 intracellular monoatomic cation homeostasis
• GO:0042928 ferrichrome import into cell
• GO:0043213 bacteriocin transport
• GO:0050821 protein stabilization
• GO:0055085 transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0009279 cell outer membrane
• GO:0016020 membrane
• GO:0098797 plasma membrane protein complex
• GO:1902495 transmembrane transporter complex

External links

• PDB: RCSB:6tyi, PDBe:6tyi, PDBj:6tyi
• PDBsum: 6tyi
• PubMed: 31602407
• UniProt: P0ABU7|EXBB_ECOLI Biopolymer transport protein ExbB (Gene Name=exbB)