Structure of PDB 6t0w Chain C |
>6t0wC (length=86) Species: 11520 (Influenza B virus) [Search protein sequence] |
NPSLRMKWAMCSNFPLALTKGDMANRIPLEYKGIQLKTNAEDIGTKGQMC SIAAVTWWNTYGPIGDTEGFERVYESFFLRKMRLDN |
|
PDB | 6t0w A Structure-Based Model for the Complete Transcription Cycle of Influenza Polymerase. |
Chain | C |
Resolution | 3.18 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
C |
C54 N56 |
C11 N13 |
|
|
|
|