Structure of PDB 6swa Chain C

Receptor sequence

>6swaC (length=363) Species: 10090 (Mus musculus) [Search protein sequence]

CARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPY
AVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMF
APTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPL
VVEDKVEGYKKTKEAVQLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRI
QRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIW
TESAFRKLDELYGTWRKAASLKSNYNLPMHKMMNTDLSRILKSPEIQRAL
RAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRVK
KLEAAATALATKS

3D structure

PDB

6swa Protein Synthesis in the Developing Neocortex at Near-Atomic Resolution Reveals Ebp1-Mediated Neuronal Proteostasis at the 60S Tunnel Exit.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	A4 R33 I36 N38 T42 N43 R45 K46 N47 N48 R49 Q50 Y52 V54 S55 A58 H60 T62 S63 T69 A72 V73 A74 R75 I76 P77 R78 R80 G82 G83 T84 H85 R86 Q89 F92 M95 R97 G98 R100 M101 F102 A103 P104 K106 R109 R110 R113 R114 N116 T118 Q119 K120 R121 K140 R143 K163 T164 K165 Q169 N178 K182 Y184 R188 M189 R190 A191 G192 K193 K195 M196 R197 N198 R199 R201 R204 R205 K219 R222 N223 S233 K234 N236 K239 G243 H245 R268 S275 L293 R303 P305 R311 R312 L314 K316 N321 L322 R323 L326 K327 K333 R336 Q343 N346 H347	A2 R31 I34 N36 T40 N41 R43 K44 N45 N46 R47 Q48 Y50 V52 S53 A56 H58 T60 S61 T67 A70 V71 A72 R73 I74 P75 R76 R78 G80 G81 T82 H83 R84 Q87 F90 M93 R95 G96 R98 M99 F100 A101 P102 K104 R107 R108 R111 R112 N114 T116 Q117 K118 R119 K138 R141 K161 T162 K163 Q167 N176 K180 Y182 R186 M187 R188 A189 G190 K191 K193 M194 R195 N196 R197 R199 R202 R203 K217 R220 N221 S231 K232 N234 K237 G241 H243 R266 S273 L291 R301 P303 R309 R310 L312 K314 N319 L320 R321 L324 K325 K331 R334 Q341 N344 H345
BS02	rna	C	P51 A53 V54 S55 K195 M196	P49 A51 V52 S53 K193 M194

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6swa, PDBe:6swa, PDBj:6swa
PDBsum	6swa
PubMed	33357414
UniProt	Q9D8E6\|RL4_MOUSE Large ribosomal subunit protein uL4 (Gene Name=Rpl4)

[Back to BioLiP]