Structure of PDB 6spf Chain C

Receptor sequence

>6spfC (length=271) Species: 287 (Pseudomonas aeruginosa) [Search protein sequence]

IVKCKPTSAGRRFVVKVVNQELHKGAPYAPLLEKKSKSGGRNNNGRITTR
HIGGGHKQHYRLVDFRRNKDGIPAIVERVEYDPNRTAHIALLKYADGERR
YIIAPKGVAAGDQLISGIGAPIKAGNSMPLRNIPVGSTVHGIELKPGKGA
QIARSAGASAQLVAREGAYVTLRLRSGEMRKVLAECRATLGEVSNSEHSL
RSLGKAGATRWRGVRPTVRGVAMNPVDHPHGGGEGRTSAGRHPVSPWGLQ
TKGKKTRSNKRTDNMIVRRRK

3D structure

PDB

6spf Structure ofPseudomonas aeruginosaribosomes from an aminoglycoside-resistant clinical isolate.

Chain

Resolution

2.89 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	K7 P8 T9 S10 A11 G12 R13 R14 F15 K18 V20 E35 K36 K39 S40 G42 R43 N44 N45 N46 G47 R48 I49 T50 T51 R52 H53 G56 H58 K59 Q60 H61 Y62 R63 R68 I74 Y83 P85 R87 D98 G99 E100 R101 K147 G149 K150 Q153 I154 A155 R156 S157 A158 Y171 L176 R177 S178 E180 R182 S198 H200 S201 S204 L205 G206 K207 A208 G209 T211 R212 W213 R214 R217 P218 T219 V220 R221 G222 V223 A224 M225 N226 P227 V228 D229 H230 H232 G234 G235 E236 G237 R238 S240 G242 R243 H244 P245 V246 S247 P248 W249 T253 K254 G255 K256 K257 T258 R259 K262 R263 T264 I268 R271 R272	K5 P6 T7 S8 A9 G10 R11 R12 F13 K16 V18 E33 K34 K37 S38 G40 R41 N42 N43 N44 G45 R46 I47 T48 T49 R50 H51 G54 H56 K57 Q58 H59 Y60 R61 R66 I72 Y81 P83 R85 D96 G97 E98 R99 K145 G147 K148 Q151 I152 A153 R154 S155 A156 Y169 L174 R175 S176 E178 R180 S196 H198 S199 S202 L203 G204 K205 A206 G207 T209 R210 W211 R212 R215 P216 T217 V218 R219 G220 V221 A222 M223 N224 P225 V226 D227 H228 H230 G232 G233 E234 G235 R236 S238 G240 R241 H242 P243 V244 S245 P246 W247 T251 K252 G253 K254 K255 T256 R257 K260 R261 T262 I266 R269 R270

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6spf, PDBe:6spf, PDBj:6spf
PDBsum	6spf
PubMed	31611393
UniProt	A0A241XHA2

[Back to BioLiP]