Structure of PDB 6s7t Chain C

Receptor sequence
>6s7tC (length=78) Species: 9606 (Homo sapiens) [Search protein sequence]
ELEAMSRYTSPVNPAVFPHLTVVLLAIGMFFTAWFFVYEVTSTKYTRDIY
KELLISLVASLFMGFGVLFLLLWVGIYV
3D structure
PDB6s7t Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
ChainC
Resolution3.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 EGY C L26 W74 V75 L25 W73 V74
BS02 KZB C F31 A34 F30 A33
Gene Ontology
Molecular Function
GO:0005515 protein binding
GO:0062062 oligosaccharyltransferase complex binding
Biological Process
GO:0006486 protein glycosylation
GO:0006487 protein N-linked glycosylation
GO:0006954 inflammatory response
GO:0034976 response to endoplasmic reticulum stress
GO:1904019 epithelial cell apoptotic process
Cellular Component
GO:0005737 cytoplasm
GO:0005783 endoplasmic reticulum
GO:0005789 endoplasmic reticulum membrane
GO:0008250 oligosaccharyltransferase complex
GO:0016020 membrane
GO:0032991 protein-containing complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s7t, PDBe:6s7t, PDBj:6s7t
PDBsum6s7t
PubMed31831667
UniProtP61165|TM258_HUMAN Transmembrane protein 258 (Gene Name=TMEM258)

[Back to BioLiP]