Structure of PDB 6s1c Chain C

Receptor sequence
>6s1cC (length=131) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
PSVDIDASQWQKLTQSREKQTTVITPLGMMMLEIQGELELPKDFASLARR
DSPNEGRFSEQDGETLIRFGSLQIDGERATLFVGKKQRLLGKVTKLDVPM
GIMHFNSKDNKVELVDVMKYKVIFKDRPLPI
3D structure
PDB6s1c Ctf18-RFC and DNA Pol ε form a stable leading strand polymerase/clamp loader complex required for normal and perturbed DNA replication.
ChainC
Resolution6.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C P2 Q36 G37 E38 L39 E40 I68 V84 Q88 F106 K126 D127 R128 P129 P1 Q35 G36 E37 L38 E39 I67 V83 Q87 F105 K125 D126 R127 P128
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006260 DNA replication
GO:0007064 mitotic sister chromatid cohesion
GO:0034398 telomere tethering at nuclear periphery
GO:0035753 maintenance of DNA trinucleotide repeats
Cellular Component
GO:0005634 nucleus
GO:0031390 Ctf18 RFC-like complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6s1c, PDBe:6s1c, PDBj:6s1c
PDBsum6s1c
PubMed32585006
UniProtP38877|CTF8_YEAST Chromosome transmission fidelity protein 8 (Gene Name=CTF8)

[Back to BioLiP]