Structure of PDB 6rn7 Chain C |
>6rn7C (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] |
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGT DECAIESIAVAATPIPKL |
|
PDB | 6rn7 DPP1 Inhibitors: Exploring the Role of Water in the S2 Pocket of DPP1 with Substituted Pyrrolidines. |
Chain | C |
Resolution | 1.66 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H381 N403 |
Catalytic site (residue number reindexed from 1) |
H10 N32 |
Enzyme Commision number |
3.4.14.1: dipeptidyl-peptidase I. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
K9W |
C |
N380 H381 A382 |
N9 H10 A11 |
PDBbind-CN: -logKd/Ki=7.30,IC50=50.1nM |
|
|
|