Structure of PDB 6rh0 Chain C |
>6rh0C (length=120) Species: 2336 (Thermotoga maritima) [Search protein sequence] |
SKKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSEFTPDLIV LDIMMPVMDGFTVLKKLQEKEEWKRIPVIVLTAKGGEEDESLALSLGARK VMRKPFSPSQFIEEVKHLLN |
|
PDB | 6rh0 Revisiting the pH-gated conformational switch on the activities of HisKA-family histidine kinases. |
Chain | C |
Resolution | 2.87 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MG |
C |
D10 X53 M55 |
D9 X52 M54 |
|
|
|
|