Structure of PDB 6r92 Chain C

Receptor sequence
>6r92C (length=117) Species: 9606 (Homo sapiens) [Search protein sequence]
KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYL
TAEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGRVTIAQGGVL
PNIQAVLLPKKTESHHK
3D structure
PDB6r92 DNA damage detection in nucleosomes involves DNA register shifting.
ChainC
Resolution4.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R12 A13 K16 T17 R18 R30 R33 R43 R78 S123 K126 R3 A4 K7 T8 R9 R21 R24 R34 R69 S114 K117
BS02 dna C R12 K14 A15 R43 V44 T77 R78 E122 R3 K5 A6 R34 V35 T68 R69 E113
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006325 chromatin organization
GO:0008285 negative regulation of cell population proliferation
GO:0031507 heterochromatin formation
GO:0061644 protein localization to CENP-A containing chromatin
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0043505 CENP-A containing nucleosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6r92, PDBe:6r92, PDBj:6r92
PDBsum6r92
PubMed31142837
UniProtP04908|H2A1B_HUMAN Histone H2A type 1-B/E (Gene Name=H2AC4)

[Back to BioLiP]