Structure of PDB 6qve Chain C

Receptor sequence

>6qveC (length=432) Species: 9606 (Homo sapiens)

MRECISIHVGQAGVQIGNACWELYCLEHGIQPDGQMPDSFNTFFSETGAG
KHVPRAVFVDLEPTVIDEVRTGTYRQLFHPEQLITGKEDAANNYARGHYT
IGKEIIDLVLDRIRKLADQCTGLQGFLVFHSFGGGTGSGFTSLLMERLSV
DYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAI
YDICRRNLDIERPTYTNLNRLISQIVSSITASLRFDGALNVDLTEFQTNL
VPYPRIHFPLATYAPVISAEKAYHEQLSVAEITNACFEPANQMVKCDPRH
GKYMACCLLYRGDVVPKDVNAAIATIKTKRSIQFVDWCPTGFKVGINYQP
PTVVPGGDLAKVQRAVCMLSNTTAIAEAWARLDHKFDLMYAKRAFVHWYV
GEGMEEGEFSEAREDMAALEKDYEEVGVDSVE

3D structure

• PDB: 6qve Structural determinants of microtubule minus end preference in CAMSAP CKK domains.
• Chain: C
• Resolution: 3.7 Å

Enzymatic activity

• Enzyme Commision number: 3.6.5.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	GTP	C	Q11 A12 Q15 E71 D98 A100 N101 S140 G143 T145 G146 Y224 N228	Q11 A12 Q15 E62 D89 A91 N92 S131 G134 T136 G137 Y215 N219

Gene Ontology

Molecular Function

• GO:0003725 double-stranded RNA binding
• GO:0003924 GTPase activity
• GO:0005198 structural molecule activity
• GO:0005200 structural constituent of cytoskeleton
• GO:0005515 protein binding
• GO:0005525 GTP binding
• GO:0016787 hydrolase activity
• GO:0031625 ubiquitin protein ligase binding

Biological Process

• GO:0000226 microtubule cytoskeleton organization
• GO:0000278 mitotic cell cycle
• GO:0007017 microtubule-based process
• GO:0030705 cytoskeleton-dependent intracellular transport
• GO:0051301 cell division
• GO:0071353 cellular response to interleukin-4

Cellular Component

• GO:0005737 cytoplasm
• GO:0005856 cytoskeleton
• GO:0005874 microtubule
• GO:0005881 cytoplasmic microtubule
• GO:0015630 microtubule cytoskeleton

External links

• PDB: RCSB:6qve, PDBe:6qve, PDBj:6qve
• PDBsum: 6qve
• PubMed: 31748546
• UniProt: P68363|TBA1B_HUMAN Tubulin alpha-1B chain (Gene Name=TUBA1B)