Structure of PDB 6qh1 Chain C

Receptor sequence
>6qh1C (length=242) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]
LEARFQQAALLKKLLDAIKELVTDANFDCNDNGISLQAMDSSHVALVSML
IKSDGFEPYRCDRNIALGINLNALSKVLRCAQNEDLVTLKAEDTPEVLNL
VFESEDRISDYDVKLMDIDQEHLGIPDIEYDATITMPAAEFQRITRDLLT
LSDSVTINASKEGVRFSCKGDIGNGSTTLKQHSIEISLTQAVTLTFSLKY
LAQFTKATPLATRVTLSMSNDVPLLVEYKMESGFLRFYLAPK
3D structure
PDB6qh1 The structure of Schizosaccharomyces pombe PCNA in complex with an Spd1 derived peptide
ChainC
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C H44 V45 D232 P234 A251 K253 H43 V44 D221 P223 A240 K242
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
Biological Process
GO:0006260 DNA replication
GO:0006271 DNA strand elongation involved in DNA replication
GO:0006272 leading strand elongation
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006298 mismatch repair
GO:0006301 postreplication repair
GO:0019985 translesion synthesis
GO:0042276 error-prone translesion synthesis
GO:0045739 positive regulation of DNA repair
GO:0045740 positive regulation of DNA replication
GO:0070914 UV-damage excision repair
GO:0070987 error-free translesion synthesis
GO:0140861 DNA repair-dependent chromatin remodeling
GO:1900264 positive regulation of DNA-directed DNA polymerase activity
GO:1903459 mitotic DNA replication lagging strand elongation
GO:1903460 mitotic DNA replication leading strand elongation
Cellular Component
GO:0000785 chromatin
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005829 cytosol
GO:0035861 site of double-strand break
GO:0043596 nuclear replication fork
GO:0043626 PCNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qh1, PDBe:6qh1, PDBj:6qh1
PDBsum6qh1
PubMed
UniProtQ03392|PCNA_SCHPO Proliferating cell nuclear antigen (Gene Name=pcn1)

[Back to BioLiP]