Structure of PDB 6q6b Chain C

Receptor sequence
>6q6bC (length=116) Species: 1200984 (Streptomyces lividans 1326) [Search protein sequence]
DREAMARCIEECLRCAQACTACADACLSEPTVADLTKCIRTDMDCADVCT
ATAAVLSRHTGYDANVTRAVLQACATVCAACGDECARHAGMHEHCRVCAE
ACRSCEQACQELLAGL
3D structure
PDB6q6b A Histidine Residue and a Tetranuclear Cuprous-thiolate Cluster Dominate the Copper Loading Landscape of a Copper Storage Protein from Streptomyces lividans.
ChainC
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CU1 C H113 C114 H94 C95
BS02 CU1 C C100 C104 C81 C85
BS03 CU1 C C41 C45 C22 C26
BS04 CU1 C C45 C57 C26 C38
BS05 CU1 C C57 C104 C38 C85
BS06 CU1 C C41 C104 C114 C22 C85 C95
BS07 CU1 C C93 C97 C74 C78
BS08 CU1 C C117 C121 C98 C102
BS09 CU1 C C104 C117 C85 C98
BS10 CU1 C C38 C100 C19 C81
BS11 CU1 C C34 C38 C15 C19
BS12 CU1 C C64 C121 C45 C102
BS13 CU1 C C64 C68 C45 C49
BS14 CU1 C C124 C128 C105 C109
BS15 CU1 C C68 C124 C49 C105
Gene Ontology
Molecular Function
GO:0046872 metal ion binding

View graph for
Molecular Function
External links
PDB RCSB:6q6b, PDBe:6q6b, PDBj:6q6b
PDBsum6q6b
PubMed31111982
UniProtQ9X8F4

[Back to BioLiP]