Structure of PDB 6pzq Chain C |
>6pzqC (length=152) Species: 11259 (Human respiratory syncytial virus A2) [Search protein sequence] |
RNPCKFEIRGHCLNGKRCHFSHNYFEWPPHALLVRQNFMLNRILKSMDEY ALGVVGVLESYIGSINNITKQSACVAMSKLLTELNSDDIKKLRDNEELNS PKIRVYNTVISYIESNRKNNKQTIHLLKRLPADVLKKTIKNTLDIHKSIT IN |
|
PDB | 6pzq Structure of the Human Respiratory Syncytial Virus M2-1 Protein in Complex with a Short Positive-Sense Gene-End RNA. |
Chain | C |
Resolution | 2.703 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
C |
C7 C15 C21 H25 |
C4 C12 C18 H22 |
|
|
|
|