Structure of PDB 6pw1 Chain C

Receptor sequence

>6pw1C (length=533) Species: 272943 (Cereibacter sphaeroides 2.4.1)

TRWFMSTNHKDIGVLYLFTGGLVGLISVAFTVYMRMELMAPGVQFMCAEH
LESGLVKGFFQSLWPSAVENCTPNGHLWNVMITGHGILMMFFVVIPALFG
GFGNYFMPLHIGAPDMAFPRMNNLSYWLYVAGTSLAVASLFAPGGNGQLG
SGIGWVLYPPLSTSESGYSTDLAIFAVHLSGASSILGAINMITTFLNMRA
PGMTMHKVPLFAWSIFVTAWLILLALPVLAGAITMLLTDRNFGTTFFQPS
GGGDPVLYQHILWFFGHPEVYIIVLPAFGIVSHVIATFAKKPIFGYLPMV
YAMVAIGVLGFVVWAHHMYTAGLSLTQQSYFMMATMVIAVPTGIKIFSWI
ATMWGGSIELKTPMLWALGFLFLFTVGGVTGIVLSQASVDRYYHDTYYVV
AHFHYVMSLGAVFGIFAGIYFWIGKMSGRQYPEWAGKLHFWMMFVGANLT
FFPQHFLGRQGMPRRYIDYPEAFATWNFVSSLGAFLSFASFLFFLGVIFY
TLTRGARVTANNYWNEHADTLEWTLTSPPPEHT

3D structure

• PDB: 6pw1 Structural changes at the surface of cytochrome c oxidase alter the proton-pumping stoichiometry.
• Chain: C
• Resolution: 2.1 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H102 D132 W172 S200 S201 H284 E286 Y288 S299 H333 H334 T359 K362 R481
• Catalytic site (residue number reindexed from 1): H85 D115 W155 S183 S184 H267 E269 Y271 S282 H316 H317 T342 K345 R464
• Enzyme Commision number: 7.1.1.9: cytochrome-c oxidase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DMU	C	M443 L519	M426 L502
BS02	HEA	C	G38 T48 M51 R52 W95 I99 H102 M106 M107 V111 G171 W172 Y414 F420 H421 M424 S425 V429 M460 F468 R481 R482 S504 F508	G21 T31 M34 R35 W78 I82 H85 M89 M90 V94 G154 W155 Y397 F403 H404 M407 S408 V412 M443 F451 R464 R465 S487 F491
BS03	HEA	C	W172 W280 V287 Y288 H333 H334 G360 G395 G398 I399 L401 S402 D407 H411 V416 H419 F420 V423 M424 R481	W155 W263 V270 Y271 H316 H317 G343 G378 G381 I382 L384 S385 D390 H394 V399 H402 F403 V406 M407 R464
BS04	CU	C	H284 H333 H334	H267 H316 H317
BS05	MG	C	H411 D412	H394 D395
BS06	CA	C	E54 A57 G59 Q61	E37 A40 G42 Q44

Gene Ontology

Molecular Function

• GO:0004129 cytochrome-c oxidase activity
• GO:0016491 oxidoreductase activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006119 oxidative phosphorylation
• GO:0009060 aerobic respiration
• GO:0015990 electron transport coupled proton transport
• GO:0022904 respiratory electron transport chain

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0045277 respiratory chain complex IV

External links

• PDB: RCSB:6pw1, PDBe:6pw1, PDBj:6pw1
• PDBsum: 6pw1
• PubMed: 31733183
• UniProt: Q3J5A7