Structure of PDB 6ppk Chain C

Receptor sequence

>6ppkC (length=260) Species: 1423 (Bacillus subtilis) [Search protein sequence]

IKKYKPTSNGRRGMTTSDFAEITTDKPEKSLLAPLHKKGGRNNQGKLTVR
HQGGGHKRQYRVIDFKRDKDGIPGRVATVEYDPNRSANIALINYADGEKR
YILAPKGIQVGTEIMSGPEADIKVGNALPLINIPVGTVVHNIELKPGKGG
QLVRSAGTSAQVLGKEGKYVLVRLNSGEVRMILSACRASIGQVGNEQHEL
INIGKAGRSRWKGIRPTVRGSVMNPNDHPPMSPWGKPTLGFKTRKKKNKS
DKFIVRRRKN

3D structure

PDB

6ppk Structural consequences of the interaction of RbgA with a 50S ribosomal subunit assembly intermediate.

Chain

Resolution

4.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	P8 T9 S10 N11 G12 R13 R14 F21 D27 K28 K31 L37 H38 K39 K40 R43 N44 N45 K48 L49 T50 V51 H53 G55 G56 H58 K59 R60 Q61 Y62 R63 I74 Y83 P85 R87 N95 D98 G99 K101 G149 K150 Q153 L154 V155 R156 S157 A158 G159 T160 L176 N177 R182 E198 H200 E201 N204 I205 G206 K207 A208 G209 R210 R212 W213 R217 P218 T219 V220 R221 G222 S223 V224 M225 N226 N228 D229 S248 P249 W250 L255 K258 T259 R260 K263 S266 K268 R274	P6 T7 S8 N9 G10 R11 R12 F19 D25 K26 K29 L35 H36 K37 K38 R41 N42 N43 K46 L47 T48 V49 H51 G53 G54 H56 K57 R58 Q59 Y60 R61 I72 Y81 P83 R85 N93 D96 G97 K99 G147 K148 Q151 L152 V153 R154 S155 A156 G157 T158 L174 N175 R180 E196 H198 E199 N202 I203 G204 K205 A206 G207 R208 R210 W211 R215 P216 T217 V218 R219 G220 S221 V222 M223 N224 N226 D227 S232 P233 W234 L239 K242 T243 R244 K247 S250 K252 R258

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0016740	transferase activity
GO:0019843	rRNA binding

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome
GO:0015934	large ribosomal subunit
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ppk, PDBe:6ppk, PDBj:6ppk
PDBsum	6ppk
PubMed	31665744
UniProt	P42919\|RL2_BACSU Large ribosomal subunit protein uL2 (Gene Name=rplB)

[Back to BioLiP]