Structure of PDB 6om0 Chain C

Receptor sequence

>6om0C (length=363) Species: 9606 (Homo sapiens) [Search protein sequence]

CARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPY
AVSELAGHQTSAESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMF
APTKTWRRWHRRVNTTQKRYAICSALAASALPALVMSKGHRIEEVPELPL
VVEDKVEGYKKTKEAVLLLKKLKAWNDIKKVYASQRMRAGKGKMRNRRRI
QRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIW
TESAFRKLDELYGTWRKAASLKSNYNLPMHKMINTDLSRILKSPEIQRAL
RAPRKKIHRRVLKKNPLKNLRIMLKLNPYAKTMRRNTILRQARNHKLRVD
KAAAAAAALQAKS

3D structure

PDB

6om0 Structural basis for selective stalling of human ribosome nascent chain complexes by a drug-like molecule.

Chain

Resolution

3.1 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	C	P51 Y52 A53 V54 E56 K195 M196	P49 Y50 A51 V52 E54 K193 M194
BS02	rna	C	R33 I36 N38 F39 T42 R45 K46 N47 N48 R49 Q50 Y52 A53 S55 E56 H60 Q61 T62 S63 G70 A72 V73 A74 R75 P77 R80 G83 T84 R86 Q89 N94 M95 C96 R97 R100 M101 F102 A103 W108 R109 R110 R113 R114 N116 T117 Q119 K120 R121 K140 R143 K163 T164 K165 K172 N178 K181 K182 Y184 R188 M189 R190 A191 G192 K193 M196 R197 N198 R199 R204 R205 D214 K219 R222 N223 K234 L235 N236 K239 P242 G243 H245 R268 K274 S275 L293 K294 Q299 P305 R306 K307 R311 R312 L314 K316 N321 L322 R323 I324 K327 K333 R342 Q343 N346 H347 R350	R31 I34 N36 F37 T40 R43 K44 N45 N46 R47 Q48 Y50 A51 S53 E54 H58 Q59 T60 S61 G68 A70 V71 A72 R73 P75 R78 G81 T82 R84 Q87 N92 M93 C94 R95 R98 M99 F100 A101 W106 R107 R108 R111 R112 N114 T115 Q117 K118 R119 K138 R141 K161 T162 K163 K170 N176 K179 K180 Y182 R186 M187 R188 A189 G190 K191 M194 R195 N196 R197 R202 R203 D212 K217 R220 N221 K232 L233 N234 K237 P240 G241 H243 R266 K272 S273 L291 K292 Q297 P303 R304 K305 R309 R310 L312 K314 N319 L320 R321 I322 K325 K331 R340 Q341 N344 H345 R348
BS03	peptide	C	W67 R71 G82 G83 T84 H85	W65 R69 G80 G81 T82 H83

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005840	ribosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6om0, PDBe:6om0, PDBj:6om0
PDBsum	6om0
PubMed	31160784
UniProt	P36578\|RL4_HUMAN Large ribosomal subunit protein uL4 (Gene Name=RPL4)

[Back to BioLiP]