Structure of PDB 6o8y Chain C

Receptor sequence

>6o8yC (length=275) Species: 1351 (Enterococcus faecalis)

AIKKYKPTTNGRRNMTSSDFAEITTSTPEKSLLQPLKNNAGRNNNGRITV
RHQGGGHKRQYRVIDFKRNKDNVAAVVKTIEYDPNRSANIALVHYEDGVK
AYILAPKGLEVGMRLVSGPEADIKVGNALPLENIPVGTVIHNIEMKPGKG
GQLIRSAGTSAQVLGKEGKYVLIRLNSGEVRMILATCRATIGSVGNEQHE
LINIGKAGRSRWMRKRPTVRGSVMNPNDHPHGGGEGKTPIGRKAPVSPWG
QPAIGYKTRNKKAKSDKLIVRRRTK

3D structure

• PDB: 6o8y Cryo-electron microscopy structure of the 70S ribosome from Enterococcus faecalis.
• Chain: C
• Resolution: 4.14 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	K7 P8 N11 G12 R13 R14 N15 K31 Q35 K38 N40 G42 R43 N44 N45 G47 I49 T50 H53 G56 H58 R60 Y62 R63 K79 Y83 P85 R87 H95 E97 D98 K101 R115 M146 K150 Q153 L154 I155 R156 S157 A158 G159 T160 Y171 R182 E198 E201 N204 I205 G206 K207 A208 G209 R210 W213 R217 P218 V220 R221 G222 V224 M225 N226 N228 D229 H230 E236 G237 K238 P240 I241 R243 K244 W250 Q252 G256 Y257 K258 T259 R260 K276	K6 P7 N10 G11 R12 R13 N14 K30 Q34 K37 N39 G41 R42 N43 N44 G46 I48 T49 H52 G55 H57 R59 Y61 R62 K78 Y82 P84 R86 H94 E96 D97 K100 R114 M145 K149 Q152 L153 I154 R155 S156 A157 G158 T159 Y170 R181 E197 E200 N203 I204 G205 K206 A207 G208 R209 W212 R216 P217 V219 R220 G221 V223 M224 N225 N227 D228 H229 E235 G236 K237 P239 I240 R242 K243 W249 Q251 G255 Y256 K257 T258 R259 K275

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0016740 transferase activity
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015934 large ribosomal subunit
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6o8y, PDBe:6o8y, PDBj:6o8y
• PDBsum: 6o8y
• PubMed: 33004869
• UniProt: A0A1B4XKR6