Structure of PDB 6o7i Chain C

Receptor sequence

>6o7iC (length=275) Species: 523850 (Thermococcus onnurineus NA1)

RFYGKIVIKGKIKAVTGLHIGSQDNPVIKDPHTGLPYIPGSSLKGRLRSL
FEILVNSRLGEWREKYPSLANYSPGSCRPDNQENCGKFFNRKINRGWIHV
CPDYETALACPVCRLFGASGKESNFPSRIIVRDAFLTKEWEEKWRAGEAI
TEAKIEVGIDRVTSQANPRTNERVVAGAEFEFEIIYNVENTTHWRDDIKN
LLTAMALLEDSYLGGSGSRGYGKVKFIFDSFEFRPLDYYRTGKDEDIVSI
DAREKSVSDILSGFDSLFSEVEGKL

3D structure

• PDB: 6o7i Second Messenger cA4Formation within the Composite Csm1 Palm Pocket of Type III-A CRISPR-Cas Csm Complex and Its Release Path.
• Chain: C
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	I23 Q26 S54 K56 G57 R58 R60 S61 I105 G129 A130 S131 S139 I167 E168 V169 I171 R173 S176 A178 R181 Y224 G226 G227 R231	I20 Q23 S42 K44 G45 R46 R48 S49 I93 G117 A118 S119 S127 I155 E156 V157 I159 R161 S164 A166 R169 Y212 G214 G215 R219
BS02	rna	C	N37 R107 P180 R181	N25 R95 P168 R169
BS03	ZN	C	H111 C122 C125	H99 C110 C113

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity

Biological Process

• GO:0051607 defense response to virus

External links

• PDB: RCSB:6o7i, PDBe:6o7i, PDBj:6o7i
• PDBsum: 6o7i
• PubMed: 31326272
• UniProt: B6YWC0