Structure of PDB 6nu6 Chain C

Receptor sequence

>6nu6C (length=228) Species: 83332 (Mycobacterium tuberculosis H37Rv)

HGGTILVVTGTGTGVGKTVVCAALASAARQAGIDVAVCKPVQTGTARGDD
DLAEVGRLAGVTQLAGLARYPQPMAPAAAAEHAGMALPARDQIVRLIADL
DRPGRLTLVEGAGGLLVELAEPGVTLRDVAVDVAAAALVVVTADLGTLNH
TKLTLEALAAQQVSCAGLVIGSWPDPPGLVAASNRSALARIAMVRAALPA
GAASLDAGDFAAMSAAAFDRNWVAGLVG

3D structure

• PDB: 6nu6 Crystal structure of Mycobacterium tuberculosis dethiobiotin synthetase in complex with fragment analogue 5
• Chain: C
• Resolution: 2.437 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): T11 G12 K15 T16 K37 T41 G54 E108
• Catalytic site (residue number reindexed from 1): T13 G14 K17 T18 K39 T43 G56 E110
• Enzyme Commision number: 6.3.3.3: dethiobiotin synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	L1V	C	T11 K15 T41 R45 P71 A73 G111 V115	T13 K17 T43 R47 P73 A75 G113 V117
BS02	L1Y	C	T11 K15 T41 R45 P71 M72 A73 A110 G111 V115	T13 K17 T43 R47 P73 M74 A75 A112 G113 V117
BS03	L1V	C	L143 G144 L146 N147	L145 G146 L148 N149
BS04	L1Y	C	L143 G144 L146 N147	L145 G146 L148 N149

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0004141 dethiobiotin synthase activity
• GO:0005524 ATP binding
• GO:0016874 ligase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0009102 biotin biosynthetic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:6nu6, PDBe:6nu6, PDBj:6nu6
• PDBsum: 6nu6
• UniProt: P9WPQ5|BIOD_MYCTU Dethiobiotin synthetase BioD (Gene Name=bioD)