Structure of PDB 6nts Chain C

Receptor sequence
>6ntsC (length=296) Species: 9606 (Homo sapiens) [Search protein sequence]
DEKVFTKELDQWIEQLNECKQLSESQVKSLCEKAKEILTKESNVQEVRCP
VTVCGDVHGQFHDLMELFRIGGKSPDTNYLFMGDYVNRGYYSVETVTLLV
ALKVRYRERITILRGNHESRQITQVYGFYDECLRKYGNANVWKYFTDLFD
YLPLTALVDGQIFCLHGGLSPSIDTLDHIRALDRLQEVPHEGPMCDLLWS
DPDDRGGWGISPRGAGYTFGQDISETFNHANGLTLVSRAHQLVMEGYNWC
HDRNVVTIFSAPNYCYRCGNQAAIMELDDTLKYSFLQFDPAPRYFL
3D structure
PDB6nts Selective PP2A Enhancement through Biased Heterotrimer Stabilization.
ChainC
Resolution3.63 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.3.16: protein-serine/threonine phosphatase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 MN C D85 N117 H118 H167 H241 D84 N116 H117 H166 H240
BS02 MN C D57 H59 D85 H118 D56 H58 D84 H117
Gene Ontology
Molecular Function
GO:0004721 phosphoprotein phosphatase activity
GO:0004722 protein serine/threonine phosphatase activity
GO:0004725 protein tyrosine phosphatase activity
GO:0005515 protein binding
GO:0016787 hydrolase activity
GO:0017018 myosin phosphatase activity
GO:0046872 metal ion binding
GO:0046982 protein heterodimerization activity
GO:0048156 tau protein binding
GO:0050811 GABA receptor binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0001932 regulation of protein phosphorylation
GO:0006470 protein dephosphorylation
GO:0007498 mesoderm development
GO:0010288 response to lead ion
GO:0010719 negative regulation of epithelial to mesenchymal transition
GO:0035331 negative regulation of hippo signaling
GO:0035556 intracellular signal transduction
GO:0035970 peptidyl-threonine dephosphorylation
GO:0040008 regulation of growth
GO:0043029 T cell homeostasis
GO:0045595 regulation of cell differentiation
GO:0051321 meiotic cell cycle
GO:0051898 negative regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction
GO:0070262 peptidyl-serine dephosphorylation
GO:0071902 positive regulation of protein serine/threonine kinase activity
GO:1900227 positive regulation of NLRP3 inflammasome complex assembly
GO:1904526 regulation of microtubule binding
GO:1904528 positive regulation of microtubule binding
GO:1904539 negative regulation of glycolytic process through fructose-6-phosphate
GO:2000045 regulation of G1/S transition of mitotic cell cycle
Cellular Component
GO:0000159 protein phosphatase type 2A complex
GO:0000775 chromosome, centromeric region
GO:0000922 spindle pole
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0005856 cytoskeleton
GO:0005886 plasma membrane
GO:0008287 protein serine/threonine phosphatase complex
GO:0015630 microtubule cytoskeleton
GO:0016020 membrane
GO:0045121 membrane raft
GO:0045202 synapse
GO:0070062 extracellular exosome
GO:0090443 FAR/SIN/STRIPAK complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6nts, PDBe:6nts, PDBj:6nts
PDBsum6nts
PubMed32315618
UniProtP67775|PP2AA_HUMAN Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform (Gene Name=PPP2CA)

[Back to BioLiP]