Structure of PDB 6nfq Chain C |
>6nfqC (length=96) Species: 294 (Pseudomonas fluorescens) [Search protein sequence] |
HAHLKSATPAADSTVAAPADLRLTFSEGVEATFTKVSLSKDGTEVAIKGL ETPDADKKTLVVTPAAPLAAGNYKVVWNAVSVDTHKSNGEYSFKVK |
|
PDB | 6nfq The crystal structure of the CopC protein from Pseudomonas fluorescens reveals amended classifications for the CopC protein family. |
Chain | C |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
C |
H25 D107 H109 |
H1 D83 H85 |
|
|
|
|