Structure of PDB 6neq Chain C

Receptor sequence

>6neqC (length=123) Species: 9913 (Bos taurus)

GKGNKPVTYEEAHAPHYIAHRKGWLSLHTGNLDGEDHAAERTVEDVFLRK
FMLGTFPGCLADQLILKRRANQVEICALVLRQLPAHKFYFLVGYSETLLS
HFYKCPVRLHLQTVPSKVVYKYI

3D structure

• PDB: 6neq Structure of Human Mitochondrial Translation Initiation Factor 3 Bound to the Small Ribosomal Subunit.
• Chain: C
• Resolution: 3.32 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	H60 H64	H16 H20

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0032543 mitochondrial translation

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005763 mitochondrial small ribosomal subunit
• GO:0005840 ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6neq, PDBe:6neq, PDBj:6neq
• PDBsum: 6neq
• PubMed: 30677741
• UniProt: Q2M2T7|RT24_BOVIN Small ribosomal subunit protein uS3m (Gene Name=MRPS24)