Structure of PDB 6n92 Chain C

Receptor sequence

>6n92C (length=260) Species: 83333 (Escherichia coli K-12)

AYQYVNVVTINKVAVIEFNYGRKLNALSKVFIDDLMQALSDLNRPEIRCI
ILRAPSGSKVFSAGHDIHELPSGGRDPLSYDDPLRQITRMIQKFPKPIIS
MVEGSVWGGAFEMIMSSDLIIAASTSTFSMTPVNLGVPYNLVGIHNLTRD
AGFHIVKELIFTASPITAQRALAVGILNHVVEVEELEDFTLQMAHHISEK
APLAIAVIKEELRVLGEAHTMNSDEFERIQGMRRAVYDSEDYQEGMNAFL
EKRKPNFVGH

3D structure

• PDB: 6n92 Sulfonate/Nitro Bearing Methylmalonyl-Thioester Isosteres Applied to Methylmalonyl-CoA Decarboxylase Structure-Function Studies.
• Chain: C
• Resolution: 1.7 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H66 L71 G110 E113 P133 V138 Y140 E228 Y238
• Catalytic site (residue number reindexed from 1): H65 L70 G109 E112 P132 V137 Y139 E227 Y237
• Enzyme Commision number: 4.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	KFV	C	K24 L25 A64 H66 D67 I68 H69 L71 W108 L136 V138 Y140 F250	K23 L24 A63 H65 D66 I67 H68 L70 W107 L135 V137 Y139 F249	MOAD: Ki=10.8uM PDBbind-CN: -logKd/Ki=4.97,Ki=10.8uM
BS02	KFV	C	W108 T128 S130 S165 P166	W107 T127 S129 S164 P165	MOAD: Ki=10.8uM PDBbind-CN: -logKd/Ki=4.97,Ki=10.8uM

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004492 methyl/ethyl malonyl-CoA decarboxylase activity
• GO:0016829 lyase activity
• GO:0016831 carboxy-lyase activity

Biological Process

• GO:0006635 fatty acid beta-oxidation

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6n92, PDBe:6n92, PDBj:6n92
• PDBsum: 6n92
• PubMed: 30869886
• UniProt: P52045|SCPB_ECOLI Methylmalonyl-CoA decarboxylase (Gene Name=scpB)