Structure of PDB 6mur Chain C

Receptor sequence

>6murC (length=278) Species: 342948 (Thermococcus onnurineus)

RFYGKIVIKGKIKAVTGLHIGSQRGIANPVIKDPHTGLPYIPGSSLKGRL
RSLFEILVNSRLGEWREKYPSLANYSPGSCRPDNQENCGKFFNRKINRGW
IHVCPDYETALACPVCRLFGASGKESNFPSRIIVRDAFLTKEWEEKWRAG
EAITEAKIEVGIDRVTSQANPRTNERVVAGAEFEFEIIYNVENTTHWRDD
IKNLLTAMALLEDSYLGGSGSRGYGKVKFIFDSFEFRPLDYYRTGKDEDI
VSIDAREKSVSDILSGFDSLFSEVEGKL

3D structure

• PDB: 6mur Type III-A CRISPR-Cas Csm Complexes: Assembly, Periodic RNA Cleavage, DNase Activity Regulation, and Autoimmunity.
• Chain: C
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	G24 S53 S54 K56 G57 R58 R60 S61 G129 A130 S131 N136 S139 I167 E168 V169 I171 R173 A178 R181 Y224 G226 G227 R231	G21 S44 S45 K47 G48 R49 R51 S52 G120 A121 S122 N127 S130 I158 E159 V160 I162 R164 A169 R172 Y215 G217 G218 R222
BS02	rna	C	N106 R107 A178 P180 R181	N97 R98 A169 P171 R172
BS03	ZN	C	H111 C113 C122 C125	H102 C104 C113 C116

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0004519 endonuclease activity

Biological Process

• GO:0051607 defense response to virus

External links

• PDB: RCSB:6mur, PDBe:6mur, PDBj:6mur
• PDBsum: 6mur
• PubMed: 30503773
• UniProt: B6YWC0