Structure of PDB 6mlc Chain C

Receptor sequence

>6mlcC (length=85) Species: 9606 (Homo sapiens)

SVWCRHCGATSAGLRCEWQNNYTQCAPCASLSSCPVCYRNYREEDLILQC
RQCDRWMHAVCQNLNTEEEVENVADIGFDCSMCRP

3D structure

• PDB: 6mlc Structural insights into trans-histone regulation of H3K4 methylation by unique histone H4 binding of MLL3/4.
• Chain: C
• Resolution: 1.8 Å

Enzymatic activity

• Enzyme Commision number: 2.1.1.364: [histone H3]-lysine(4) N-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	Y1094 E1096 E1097 D1098 I1100 L1101 W1109 E1120	Y41 E43 E44 D45 I47 L48 W56 E67
BS02	ZN	C	C1069 C1078 C1081	C16 C25 C28
BS03	ZN	C	C1087 C1090 H1111 C1114	C34 C37 H58 C61
BS04	ZN	C	C1103 C1106 C1133 C1136	C50 C53 C80 C83
BS05	ZN	C	C1057 C1060	C4 C7

External links

• PDB: RCSB:6mlc, PDBe:6mlc, PDBj:6mlc
• PDBsum: 6mlc
• PubMed: 30604749
• UniProt: Q8NEZ4|KMT2C_HUMAN Histone-lysine N-methyltransferase 2C (Gene Name=KMT2C)