Structure of PDB 6m4g Chain C

Receptor sequence
>6m4gC (length=90) Species: 9606 (Homo sapiens) [Search protein sequence]
SRTVRAELSFSVSQVERSLREGHYAQRLSRTAPVYLAAVIEYLTAKVLEL
AGNEAQNSGERNITPLLLDMVVHNDRLLSTLFNTTTISQV
3D structure
PDB6m4g Structural basis of nucleosome dynamics modulation by histone variants H2A.B and H2A.Z.2.2.
ChainC
Resolution2.8 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R39 R46 L47 S48 R49 R20 R27 L28 S29 R30
BS02 dna C R21 R24 S32 R2 R5 S13
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0006334 nucleosome assembly
GO:0006397 mRNA processing
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0000791 euchromatin
GO:0005634 nucleus
GO:0005694 chromosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6m4g, PDBe:6m4g, PDBj:6m4g
PDBsum6m4g
PubMed33073403
UniProtP0C5Z0|H2AB2_HUMAN Histone H2A-Bbd type 2/3 (Gene Name=H2AB2)

[Back to BioLiP]