Structure of PDB 6ly5 Chain C

Receptor sequence

>6ly5C (length=163) [Search protein sequence]

EMSESLPFLPRPEKLDGSMAGDRGFDPMGLSEIQQDLTYARWAELKHGRI
AMLAIVGMIVQEYIHLPGEAYQNPDPFGAISTVGLGVNGQIFAAIGCVEL
INFNKHYDGSEPGDIGWTGGLLKNKSPAEIMKAKEQEITHCRLAMIAITG
ATVQTLLFHQPLL

3D structure

PDB

6ly5 Structural basis for energy transfer in a huge diatom PSI-FCPI supercomplex.

Chain

Resolution

2.38 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	DD6	C	D60 L64 A88 M179 I182	D26 L30 A54 M145 I148
BS02	A86	C	M86 I89 W151 T152 G153 L177 A181 Q188 L196	M52 I55 W117 T118 G119 L143 A147 Q154 L162
BS03	A86	C	I125 F126 F137	I91 F92 F103
BS04	CLA	C	E38 S39 L40	E4 S5 L6
BS05	CLA	C	Q170 T173 H174	Q136 T139 H140
BS06	CLA	C	L49 G55 R57 F59 A74 E78 H81 R176 M179	L15 G21 R23 F25 A40 E44 H47 R142 M145
BS07	CLA	C	L87 A88 G91 Q95 L100 Y105 V121 W151	L53 A54 G57 Q61 L66 Y71 V87 W117
BS08	CLA	C	Y105 V121 Q124	Y71 V87 Q90
BS09	CLA	C	Y73 W76 A77 K80 H81 F126 G130 E133 F137 H140	Y39 W42 A43 K46 H47 F92 G96 E99 F103 H106
BS10	CLA	C	R83 M86 L87 D148 I149 W151 T152 L156 A167 E171 H174	R49 M52 L53 D114 I115 W117 T118 L122 A133 E137 H140
BS11	KC1	C	Q170 H174	Q136 H140
BS12	CLA	C	G184 Q188 F192	G150 Q154 F158
BS13	CLA	C	M62 L64	M28 L30

Gene Ontology

	Biological Process
GO:0009765	photosynthesis, light harvesting

	Cellular Component
GO:0016020	membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6ly5, PDBe:6ly5, PDBj:6ly5
PDBsum	6ly5
PubMed	33033236
UniProt	A0A6J4B024

[Back to BioLiP]