Structure of PDB 6lsr Chain C

Receptor sequence

>6lsrC (length=92) Species: 9606 (Homo sapiens)

SKNHTTHNQSRKWHRNGIKKPRSQRYESLKGVDPKFLRNMRFAKKHNKKG
LKKMQANNAKAMSARKLDRLAYIAHPKLGKRARARIAKGLRL

3D structure

• PDB: 6lsr Structural snapshots of human pre-60S ribosomal particles before and after nuclear export.
• Chain: C
• Resolution: 3.13 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	K5 N6 H7 T9 H10 N11 Q12 S13 R14 K15 H17 R18 N19 K22 K23 R25 R28 Y29 L32 K33 D36 P37 F39 R41 N42 R44 F45 A46 K47 K48 H49 N50 K51 K52 K56 M57 N60 N61 R91 R95 Y98 P102 K103 R107 R111 G115 R117	K2 N3 H4 T6 H7 N8 Q9 S10 R11 K12 H14 R15 N16 K19 K20 R22 R25 Y26 L29 K30 D33 P34 F36 R38 N39 R41 F42 A43 K44 K45 H46 N47 K48 K49 K53 M54 N57 N58 R65 R69 Y72 P76 K77 R81 R85 G89 R91

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0008201 heparin binding
• GO:0045296 cadherin binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation
• GO:0007566 embryo implantation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0016020 membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:0022626 cytosolic ribosome
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6lsr, PDBe:6lsr, PDBj:6lsr
• PDBsum: 6lsr
• PubMed: 32669547
• UniProt: P47914|RL29_HUMAN Large ribosomal subunit protein eL29 (Gene Name=RPL29)