Structure of PDB 6lr4 Chain C

Receptor sequence

>6lr4C (length=243) Species: 9606 (Homo sapiens) [Search protein sequence]

GAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASV
VWFILVHVTDRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGL
ASLSEDGRSPISIRQMAYVSGLSFGIISGVFSVINILADALGPGVVGIHG
DSPYYFLTSAFLTAAIILLHTFWGVVFFDACERRRYWALGLVVGSHLLTS
GLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQRSLL

3D structure

PDB

6lr4 Structural basis of gamma-secretase inhibition and modulation by small molecule drugs.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLR	C	G202 F205 L206	G201 F204 L205
BS02	CLR	C	S223 W227	S222 W226

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0019899	enzyme binding
GO:0030674	protein-macromolecule adaptor activity
GO:0061133	endopeptidase activator activity

	Biological Process
GO:0001656	metanephros development
GO:0006509	membrane protein ectodomain proteolysis
GO:0007219	Notch signaling pathway
GO:0007220	Notch receptor processing
GO:0010950	positive regulation of endopeptidase activity
GO:0016485	protein processing
GO:0031293	membrane protein intracellular domain proteolysis
GO:0034205	amyloid-beta formation
GO:0042982	amyloid precursor protein metabolic process
GO:0042987	amyloid precursor protein catabolic process
GO:0043085	positive regulation of catalytic activity

	Cellular Component
GO:0000139	Golgi membrane
GO:0005769	early endosome
GO:0005783	endoplasmic reticulum
GO:0005789	endoplasmic reticulum membrane
GO:0005794	Golgi apparatus
GO:0005886	plasma membrane
GO:0008021	synaptic vesicle
GO:0010008	endosome membrane
GO:0016020	membrane
GO:0032580	Golgi cisterna membrane
GO:0042734	presynaptic membrane
GO:0070765	gamma-secretase complex
GO:0097060	synaptic membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6lr4, PDBe:6lr4, PDBj:6lr4
PDBsum	6lr4
PubMed	33373587
UniProt	Q96BI3\|APH1A_HUMAN Gamma-secretase subunit APH-1A (Gene Name=APH1A)

[Back to BioLiP]