Structure of PDB 6lk2 Chain C

Receptor sequence
>6lk2C (length=344) Species: 1256987 (Providencia alcalifaciens F90-2004) [Search protein sequence]
MEKVTVTLDERSYPINIAPSLYQQQDAFWPLTAGQRAMIVTNETLAPLYL
HKIQTVLEVSGVKVDSIILPDGEQYKSLFIMNDVFTALLEKHHNRDTTLI
ALGGGVIGDLTGFAAASYQRGVRFIQVPTTLLSQVDSSVGGKTAVNHPLG
KNMIGAFYQPASVVIDLDCLKTLPKRELSSGLAEVIKYGIILDGEFFSWL
EENIDALMALDNQAMAYCIRRCCELKAQVVAADEGLRALLNLGHTFGHAI
EAEMGYGVWLHGEAVAAGMVMAAKTAELIGQFTPEQTDRVIALLKRAELP
VTGPAKMQPDDYLPHMMLHLILPTTIGHSEMRSDVDASTVTAAI
3D structure
PDB6lk2 Structural and Biochemical Analyses Reveal that Chlorogenic Acid Inhibits the Shikimate Pathway.
ChainC
Resolution2.503 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAD C L45 D71 E73 K76 G104 G105 V106 D109 T129 T130 L132 D136 S137 K142 K151 T172 E177 L45 D71 E73 K76 G104 G105 V106 D109 T129 T130 L132 D136 S137 K142 K151 T172 E177
BS02 MG C E184 H248 H265 E184 H244 H261
BS03 7LH C D136 K142 K226 R241 N245 H248 D136 K142 K226 R237 N241 H244 MOAD: Kd=0.5uM
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 13:25:03 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6lk2', asym_id = 'C', title = 'Structural and Biochemical Analyses Reveal that Chlorogenic Acid Inhibits the Shikimate Pathway.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6lk2', asym_id='C', title='Structural and Biochemical Analyses Reveal that Chlorogenic Acid Inhibits the Shikimate Pathway.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003856,0005737,0009073,0016838', uniprot = '', pdbid = '6lk2', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003856,0005737,0009073,0016838', uniprot='', pdbid='6lk2', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>