Structure of PDB 6lax Chain C

Receptor sequence
>6laxC (length=92) Species: 9606 (Homo sapiens) [Search protein sequence]
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVKRSLKMRGQAF
VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMA
3D structure
PDB6lax SAM-VI riboswitch structure and signature for ligand discrimination.
ChainC
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C Y13 N15 N16 E19 K20 K22 K23 D24 K46 R47 S48 L49 K50 M51 R52 G53 Q54 F56 Q85 Y86 A87 K88 T89 D90 S91 D92 Y7 N9 N10 E13 K14 K16 K17 D18 K40 R41 S42 L43 K44 M45 R46 G47 Q48 F50 Q79 Y80 A81 K82 T83 D84 S85 D86
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding

View graph for
Molecular Function
External links
PDB RCSB:6lax, PDBe:6lax, PDBj:6lax
PDBsum6lax
PubMed31844059
UniProtP09012|SNRPA_HUMAN U1 small nuclear ribonucleoprotein A (Gene Name=SNRPA)

[Back to BioLiP]