Structure of PDB 6kvd Chain C

Receptor sequence
>6kvdC (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
RAKAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTA
EILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPN
IQAVLLP
3D structure
PDB6kvd Biochemical and structural analyses of the nucleosome containing human histone H2A.J.
ChainC
Resolution2.21 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C R11 A12 A14 K15 R17 R32 R42 R77 R1 A2 A4 K5 R7 R22 R32 R67
BS02 dna C R11 R29 R42 V43 G44 A45 K75 T76 R77 R1 R19 R32 V33 G34 A35 K65 T66 R67
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
Biological Process
GO:0007283 spermatogenesis
GO:0008150 biological_process
GO:0021987 cerebral cortex development
GO:0031507 heterochromatin formation
GO:0071480 cellular response to gamma radiation
GO:0090398 cellular senescence
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kvd, PDBe:6kvd, PDBj:6kvd
PDBsum6kvd
PubMed31793981
UniProtQ9BTM1|H2AJ_HUMAN Histone H2A.J (Gene Name=H2AJ)

[Back to BioLiP]