Structure of PDB 6klb Chain C |
>6klbC (length=117) Species: 386891 (Moraxella bovoculi) [Search protein sequence] |
HNDEMYLVVQALIRACIIKEIDLYTEQLYNIIKSLPYDKRPNVVYSDQPL DPNNLDLSEPELWAEQVGECMRYAHNDQPCFYIGSTKRELRVNYIVPVIG VRDEIERVMTLEEVRNL |
|
PDB | 6klb Structural insight into multistage inhibition of CRISPR-Cas12a by AcrVA4. |
Chain | C |
Resolution | 4.1 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
C |
T201 K202 |
T86 K87 |
|
|
|