Structure of PDB 6jlh Chain C

Receptor sequence

>6jlhC (length=256) Species: 7955 (Danio rerio)

GFLQIWQHFDADDNGYIEGKELDDFFRHMLKKLQPKDKITDERVQQIKKS
FMSAYDATFDGRLQIEELANMILPQEENFLLIFRREAPLDNSVEFMKIWR
KYDADSSGYISAAELKNFLKDLFLQHKKKIPPNKLDEYTDAMMKIFDKNK
DGRLDLNDLARILALQENFLLQFKMDASSQVERKRDFEKIFAHYDVSRTG
ALEGPEVDGFVKDMMELVRPSISGGDLDKFRECLLTHCDMNKDGKIQKSE
LALCLG

3D structure

• PDB: 6jlh Structural and mechanistic insights into secretagogin-mediated exocytosis.
• Chain: C
• Resolution: 2.37 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	M186 A188 S189 R194 F221 M225 M226 L228 V229 F241 L245 L266	M175 A177 S178 R183 F210 M214 M215 L217 V218 F230 L234 L255
BS02	CA	C	D67 T69 D71 R73 E78	D56 T58 D60 R62 E67
BS03	CA	C	D21 D23 N25 Y27 E32	D10 D12 N14 Y16 E21
BS04	CA	C	D158 N160 D162 R164	D147 N149 D151 R153
BS05	CA	C	D114 D116 S118 Y120 E125	D103 D105 S107 Y109 E114
BS06	CA	C	D250 N252 D254 K256 Q258 E261	D239 N241 D243 K245 Q247 E250
BS07	CA	C	D206 S208 T210 A212 E214 E217	D195 S197 T199 A201 E203 E206

Gene Ontology

Molecular Function

• GO:0005509 calcium ion binding
• GO:0046872 metal ion binding

Biological Process

• GO:0007420 brain development
• GO:0021522 spinal cord motor neuron differentiation
• GO:0099509 regulation of presynaptic cytosolic calcium ion concentration
• GO:1900271 regulation of long-term synaptic potentiation

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0030425 dendrite
• GO:0043195 terminal bouton
• GO:0045202 synapse

External links

• PDB: RCSB:6jlh, PDBe:6jlh, PDBj:6jlh
• PDBsum: 6jlh
• PubMed: 32156735
• UniProt: Q5XJX1|SEGN_DANRE Secretagogin (Gene Name=scgn)