Structure of PDB 6is3 Chain C |
>6is3C (length=121) Species: 273036 (Staphylococcus aureus RF122) [Search protein sequence] |
HHHTQILIVEDEQNLARFLELELTHENYNVDTEYDGQDGLDKALSHYYDL IILDLMLPSINGLEICRKIRQQQSTPIIIITAKSDTYDKVAGLDYGADDY IVKPFDIEELLARIRAILRRQ |
|
PDB | 6is3 Deciphering the activation and recognition mechanisms of Staphylococcus aureus response regulator ArlR. |
Chain | C |
Resolution | 1.549 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CA |
C |
D9 D52 M54 |
D11 D54 M56 |
|
|
|
|