Structure of PDB 6ii6 Chain C

Receptor sequence
>6ii6C (length=164) Species: 9606 (Homo sapiens) [Search protein sequence]
KKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFT
VWDVGGLDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAED
ELRDAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGD
GLYEGLDWLANQLE
3D structure
PDB6ii6 Makes caterpillars floppy-like effector-containing MARTX toxins require host ADP-ribosylation factor (ARF) proteins for systemic pathogenicity.
ChainC
Resolution2.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GTP C D26 A27 G29 K30 T31 T32 T45 T48 G70 N126 K127 D129 C159 A160 T161 D12 A13 G15 K16 T17 T18 T31 T34 G56 N112 K113 D115 C145 A146 T147
BS02 MG C T31 T48 T17 T34
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
Biological Process
GO:0006886 intracellular protein transport
GO:0006890 retrograde vesicle-mediated transport, Golgi to endoplasmic reticulum
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
Cellular Component
GO:0000139 Golgi membrane
GO:0005737 cytoplasm
GO:0005794 Golgi apparatus
GO:0005886 plasma membrane
GO:0048471 perinuclear region of cytoplasm
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6ii6, PDBe:6ii6, PDBj:6ii6
PDBsum6ii6
PubMed31427506
UniProtP61204|ARF3_HUMAN ADP-ribosylation factor 3 (Gene Name=ARF3)

[Back to BioLiP]