Structure of PDB 6ic5 Chain C |
>6ic5C (length=68) Species: 9606 (Homo sapiens) [Search protein sequence] |
PFNPFELTNHAVLLVGYGTDSASGMDYWIVKNSWGTGWGENGYFRIRRGT DECAIESIAVAATPIPKL |
|
PDB | 6ic5 Structure-based design and in vivo anti-arthritic activity evaluation of a potent dipeptidyl cyclopropyl nitrile inhibitor of cathepsin C. |
Chain | C |
Resolution | 2.0 Å |
3D structure |
|
|
Catalytic site (original residue number in PDB) |
H381 N403 |
Catalytic site (residue number reindexed from 1) |
H10 N32 |
Enzyme Commision number |
3.4.14.1: dipeptidyl-peptidase I. |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
HB5 |
C |
T379 N380 I429 |
T8 N9 I58 |
PDBbind-CN: -logKd/Ki=8.22,IC50=6nM |
|
|
|