Structure of PDB 6hx2 Chain C |
>6hx2C (length=150) Species: 272626 (Listeria innocua Clip11262) [Search protein sequence] |
VDTKEFLNHQVANLNVFTVKIHQIHWYMRGHNFFTLHEKMDDLYSEFGEQ MDEVAERLLAIGGSPFSTLKEFLENASVEEAPYTKPKTMDQLMEDLVGTL ELLRDEYKQGIELTDKEGDDVTNDMLIAFKASIDKHIWMFKAFLGKAPLE |
|
PDB | 6hx2 Metal Positions and Translocation Pathways of the Dodecameric Ferritin-like Protein Dps. |
Chain | C |
Resolution | 1.597 Å |
3D structure |
|
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CO |
C |
D59 E63 |
D52 E56 |
|
|
|
|