Structure of PDB 6hqu Chain C

Receptor sequence
>6hquC (length=210) Species: 186497 (Pyrococcus furiosus DSM 3638) [Search protein sequence]
ATIGRISTGSKSLDKLLGGGIETQAITEVFGEFGSGKTQLAHTLAVMVQL
PPEEGGLNGSAMYIDTENTFRPERLREIAQNRGLDPDEVLDNVAYARAFN
SNHQMQLLYQASAMMVESLNTDRPYKLLIVDSLTSHFRAERQQKLARFLR
MLHRLANEFDIAVFVTNQVGHILAHSATLRVYLRKGKGGKRIARLIGEAV
FSITEKGIED
3D structure
PDB6hqu Improved RAD51 binders through motif shuffling based on the modularity of BRC repeats.
ChainC
Resolution1.97 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C M169 P179 L197 V200 A201 Y202 A203 Q217 A220 M221 E224 M62 P72 L90 V93 A94 Y95 A96 Q110 A113 M114 E117
BS02 ADP C G141 S142 G143 K144 T145 Q146 R181 R323 I342 T343 G34 S35 G36 K37 T38 Q39 R74 R191 I203 T204
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Thu Nov 28 04:31:03 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '6hqu', asym_id = 'C', title = 'Improved RAD51 binders through motif shuffling based on the modularity of BRC repeats.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='6hqu', asym_id='C', title='Improved RAD51 binders through motif shuffling based on the modularity of BRC repeats.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0003677,0003684,0005524,0006259,0006281,0006310,0008094,0016887,0140664', uniprot = '', pdbid = '6hqu', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003677,0003684,0005524,0006259,0006281,0006310,0008094,0016887,0140664', uniprot='', pdbid='6hqu', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>