Structure of PDB 6hit Chain C

Receptor sequence

>6hitC (length=142) Species: 8049 (Gadus morhua)

SLSSKQKATVKDFFSKMSTRSDDIGAEALSRLVAVYPQTKSYFSHWKDAS
PGSAPVRKHGITIMGGVYDAVGKIDDLKGGLLSLSELHAFMLRVDPVNFK
LLAHCMLVCMSMIFPEEFTPQVHVAVDKFLAQLALALAEKYR

3D structure

• PDB: 6hit The crystal structure of haemoglobin from Atlantic cod.
• Chain: C
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Y43 F44 H46 H60 T63 L85 H89 L93 N99 L103	Y42 F43 H45 H59 T62 L84 H88 L92 N98 L102

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:6hit, PDBe:6hit, PDBj:6hit
• PDBsum: 6hit
• PubMed: 31397324
• UniProt: O42425|HBA2_GADMO Hemoglobin subunit alpha-2 (Gene Name=hba2)