Structure of PDB 6hct Chain C

Receptor sequence
>6hctC (length=117) Species: 224325 (Archaeoglobus fulgidus DSM 4304) [Search protein sequence]
SYVRFEVPEDMQNEALSLLEKVRESGKVKKGTNETTKAVERGLAKLVYIA
EDVDPPEIVAHLPLLCEEKNVPYIYVKSKNDLGRAVGIEVPCASAAIINE
GELRKELGSLVEKIKGL
3D structure
PDB6hct The role of RNA structure in translational regulation by L7Ae protein in archaea.
ChainC
Resolution3.091 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C K30 G31 T32 N33 E34 V53 D54 I58 K79 I88 E89 V90 P91 C92 A93 K30 G31 T32 N33 E34 V53 D54 I58 K79 I88 E89 V90 P91 C92 A93
BS02 rna C N33 E34 N33 E34
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0004526 ribonuclease P activity
GO:0019843 rRNA binding
Biological Process
GO:0001682 tRNA 5'-leader removal
GO:0006412 translation
GO:0008033 tRNA processing
GO:0042254 ribosome biogenesis
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6hct, PDBe:6hct, PDBj:6hct
PDBsum6hct
PubMed30327333
UniProtO29494|RL7A_ARCFU Large ribosomal subunit protein eL8 (Gene Name=rpl7ae)

[Back to BioLiP]