Structure of PDB 6h7b Chain C

Receptor sequence

>6h7bC (length=77) Species: 5664 (Leishmania major)

LPPITPQELESMSPQEQRAALGDRLFLKVYEIAPELAPKITGMFLEMKPK
EAYELLNDQKRLEERVTEALCVLKAHQ

3D structure

• PDB: 6h7b The Leishmania PABP1-eIF4E4 interface: a novel 5'-3' interaction architecture for trans-spliced mRNAs.
• Chain: C
• Resolution: 1.89 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	R546 E549	R65 E68
BS02	peptide	C	G503 D504 F507 P519 K520 T522 G523 M524 L526 E527 E549 A550 V553	G22 D23 F26 P38 K39 T41 G42 M43 L45 E46 E68 A69 V72

Gene Ontology

Molecular Function

• GO:0003723 RNA binding

External links

• PDB: RCSB:6h7b, PDBe:6h7b, PDBj:6h7b
• PDBsum: 6h7b
• PubMed: 30476241
• UniProt: E9AFX7