Structure of PDB 6fci Chain C

Receptor sequence

>6fciC (length=179) Species: 9606 (Homo sapiens)

ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLK
ATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASY
SLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVL
ECVSLVELTSLKGREKLAPVPFFSLLQYE

3D structure

• PDB: 6fci Structural Insights into the Forward and Reverse Enzymatic Reactions in Human Adenine Phosphoribosyltransferase.
• Chain: C
• Resolution: 1.94 Å

Enzymatic activity

• Enzyme Commision number: 2.4.2.7: adenine phosphoribosyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PRP	C	R87 K91	R86 K90
BS02	PRP	C	S66 R67 K88 L103 E104 Y105 D127 D128 L129 A131 T132 G133 T135	S65 R66 K87 L102 E103 Y104 D126 D127 L128 A130 T131 G132 T134
BS03	ADE	C	F26 R27 R67 E104 Y105 L129	F25 R26 R66 E103 Y104 L128

Gene Ontology

Molecular Function

• GO:0002055 adenine binding
• GO:0003999 adenine phosphoribosyltransferase activity
• GO:0005515 protein binding
• GO:0016208 AMP binding
• GO:0016757 glycosyltransferase activity

Biological Process

• GO:0006166 purine ribonucleoside salvage
• GO:0006168 adenine salvage
• GO:0007625 grooming behavior
• GO:0032263 GMP salvage
• GO:0032264 IMP salvage
• GO:0044209 AMP salvage
• GO:0046083 adenine metabolic process

Cellular Component

• GO:0005576 extracellular region
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0034774 secretory granule lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:6fci, PDBe:6fci, PDBj:6fci
• PDBsum: 6fci
• PubMed: 29576532
• UniProt: P07741|APT_HUMAN Adenine phosphoribosyltransferase (Gene Name=APRT)