Structure of PDB 6f7g Chain C

Receptor sequence
>6f7gC (length=98) Species: 562 (Escherichia coli) [Search protein sequence]
AAMAEQRHQEWLRFVDLLKNAYQNDLHLPLLNLMLTPDEREALGTRVRIV
EELLRGEMSQRELKNELGAGIATITRGSNSLKAAPVELRQWLEEVLLK
3D structure
PDB6f7g Tryptophan Repressor TrpR: A ligand specificity study
ChainC
Resolution1.656 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CVW C L41 L43 T44 L33 L35 T36 BindingDB: Kd=2.88e+4nM
BS02 CVW C R54 R84 G85 S88 R46 R76 G77 S80 BindingDB: Kd=2.88e+4nM
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6f7g, PDBe:6f7g, PDBj:6f7g
PDBsum6f7g
PubMed
UniProtP0A881|TRPR_ECOLI Trp operon repressor (Gene Name=trpR)

[Back to BioLiP]