Structure of PDB 6eo0 Chain C

Receptor sequence

>6eo0C (length=274) Species: 7955 (Danio rerio)

PFTKMTRPSSDLTAFREHFAKAKHIAIITGAGVSAESGVPTFRGPGGFWR
KWQAQDLATPEAFSRDPSLVWEFYHYRREVMRSKMPNPAHLAIAECEARL
GQQGRSVVIITQNIDELHHRAGSKHVYEIHGSLFKTRCMSCGEVKANHKS
PICPALDGKGAPDPNTKEARIPVELLPRCERKSCNGLLRPHVVWFGETLD
SDILTAVERELEKCDLCLVVGTSSIVYPAAMFAPQVASRGVPVAEFNMEC
TPATQRFKYHFEGPCGSTLPPALE

3D structure

• PDB: 6eo0 Mechanism-Based Inhibitors of the Human Sirtuin 5 Deacylase: Structure-Activity Relationship, Biostructural, and Kinetic Insight.
• Chain: C
• Resolution: 2.4 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): P64 T65 F66 R67 N137 D139 H154
• Catalytic site (residue number reindexed from 1): P40 T41 F42 R43 N113 D115 H130
• Enzyme Commision number: 2.3.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	BV8	C	E232 Y251 M255 F256	E208 Y227 M231 F232
BS02	BVT	C	E232 Y251 M255 F256	E208 Y227 M231 F232
BS03	ZN	C	C162 C165 C203 C208	C138 C141 C179 C184
BS04	BVT	C	G54 A55 G56 F66 R67 Y98 R101 Q136 I138 H154 F219 G220 E221 T222 G245 T246 S247 V250 Y251 N271 M272 C289	G30 A31 G32 F42 R43 Y74 R77 Q112 I114 H130 F195 G196 E197 T198 G221 T222 S223 V226 Y227 N247 M248 C265

Gene Ontology

Molecular Function

• GO:0036054 protein-malonyllysine demalonylase activity
• GO:0036055 protein-succinyllysine desuccinylase activity
• GO:0070403 NAD+ binding

External links

• PDB: RCSB:6eo0, PDBe:6eo0, PDBj:6eo0
• PDBsum: 6eo0
• PubMed: 29044784
• UniProt: Q6DHI5|SIR5_DANRE NAD-dependent protein deacylase sirtuin-5, mitochondrial (Gene Name=sirt5)