Structure of PDB 6em1 Chain C

Receptor sequence

>6em1C (length=343) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

SRPQVTVHSLTGEATANALPLPAVFSAPIRPDIVHTVFTSVNKNKRQAYA
VSEKAGHQTSAESWGTGRAVARIPRVGGGGTGRSGQGAFGNMCRGGRMFA
PTKTWRKWNVKVNHNEKRYATASAIAATAVASLVLARGHRVEKIPEIPLV
VSTDLESIQKTKEAVAALKAVGAHSDLLKVLKSKKLRAGKGKYRNRRWTQ
RRGPLVVYAEDNGIVKALRNVPGVETANVASLNLLQLAPGAHLGRFVIWT
EAAFTKLDQVWGSETVASSKVGYTLPSHIISTSDVTRIINSSEIQSAIRP
AGQATQKRTHVLKKNPLKNKQVLLRLNPYAKVFAAEKLGSKKA

3D structure

PDB

6em1 Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.

Chain

Resolution

3.6 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	R31 I34 H36 T40 K44 N45 K46 R47 Q48 Y50 V52 S53 A56 H58 Q59 S61 S64 V71 R73 I74 P75 R76 G80 G81 T82 R84 Q87 G88 N92 M93 C94 R95 G96 R98 M99 F100 A101 P102 R107 K108 K112 V113 N114 H115 N116 K118 R119 R138 R141 K161 T162 K186 R188 A189 G190 K191 K193 Y194 R195 R197 W199 R202 R203 Y209 V216 R220 N221 T227 A228 A231 S232 N234 P240 G241 H243 K271 V272 I290 N291 S292 S293 Q296 R300 A302 G303 Q304 A305 T306 K308 R309 V312 L313 K315 N320 Q322 R326 A331 K332 F334 S341 K342	R30 I33 H35 T39 K43 N44 K45 R46 Q47 Y49 V51 S52 A55 H57 Q58 S60 S63 V70 R72 I73 P74 R75 G79 G80 T81 R83 Q86 G87 N91 M92 C93 R94 G95 R97 M98 F99 A100 P101 R106 K107 K111 V112 N113 H114 N115 K117 R118 R137 R140 K160 T161 K185 R187 A188 G189 K190 K192 Y193 R194 R196 W198 R201 R202 Y208 V215 R219 N220 T226 A227 A230 S231 N233 P239 G240 H242 K270 V271 I289 N290 S291 S292 Q295 R299 A301 G302 Q303 A304 T305 K307 R308 V311 L312 K314 N319 Q321 R325 A330 K331 F333 S340 K341
BS02	rna	C	S53 T105 K193 Y194	S52 T104 K192 Y193

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6em1, PDBe:6em1, PDBj:6em1
PDBsum	6em1
PubMed	29245012
UniProt	P10664\|RL4A_YEAST Large ribosomal subunit protein uL4A (Gene Name=RPL4A)

[Back to BioLiP]