Structure of PDB 6el3 Chain C

Receptor sequence

>6el3C (length=364) Species: 3702 (Arabidopsis thaliana)

FESVALIIGVTGIVGNSLAEILPLSDTPGGPWKVYGVARRPRPTWNADHP
IDYIQCDVSDAEDTRSKLSPLTDVTHVFYVTWTNRESESENCEANGSMLR
NVLQAIIPYAPNLRHVCLQTGTKHYLGPFTNVDGPRHDPPFTEDMPRLQI
QNFYYTQEDILFEEIKKIETVTWSIHRPNMIFGFSPYSLMNIVGTLCVYA
AICKHEGSPLLFPGSKKAWEGFMTASDADLIAEQQIWAAVDPYAKNEAFN
CNNADIFKWKHLWKILAEQFGIEEYGFEEGKNLGLVEMMKGKERVWEEMV
KENQLQEKKLEEVGVWWFADVILGVEGMIDSMNKSKEYGFLGFRNSNNSF
ISWIDKYKAFKIVP

3D structure

• PDB: 6el3 PRISEs (progesterone 5 beta-reductase and/or iridoid synthase-like 1,4-enone reductases): Catalytic and substrate promiscuity allows for realization of multiple pathways in plant metabolism.
• Chain: C
• Resolution: 1.899 Å

Enzymatic activity

• Enzyme Commision number: 1.3.1.3: Delta(4)-3-oxosteroid 5beta-reductase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	C	G33 T35 G36 I37 A62 R63 R64 C80 D81 V82 T105 W106 M122 Q143 T144 Y178 N203 I205 S212 L213 M214	G9 T11 G12 I13 A38 R39 R40 C56 D57 V58 T81 W82 M98 Q119 T120 Y154 N179 I181 S188 L189 M190

Gene Ontology

Molecular Function

• GO:0016491 oxidoreductase activity
• GO:0016627 oxidoreductase activity, acting on the CH-CH group of donors
• GO:0035671 enone reductase activity
• GO:0046983 protein dimerization activity
• GO:0047787 Delta4-3-oxosteroid 5beta-reductase activity

Biological Process

• GO:0008202 steroid metabolic process
• GO:0009611 response to wounding
• GO:0010051 xylem and phloem pattern formation

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:6el3, PDBe:6el3, PDBj:6el3
• PDBsum: 6el3
• PubMed: 30172078
• UniProt: Q9STX2|VEP1_ARATH 3-oxo-Delta(4,5)-steroid 5-beta-reductase (Gene Name=VEP1)