Structure of PDB 6e49 Chain C

Receptor sequence
>6e49C (length=254) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
MLEAKFEEASLFKRIIDGFKDCVQLVNFQCKEDGIIAQAVDDSRVLLVSL
EIGVEAFQEYRCDHPVTLGMDLTSLSKILRCGNNTDTLTLIADNTPDSII
LLFEDTKKDRIAEYSLKLMDIDADFLKIEELQYDSTLSLPSSEFSKIVRD
LSQLSDSINIMITKETIKFVADGDIGSGSVIIKPFVDMEHPETSIKLEMD
QPVDLTFGAKYLLDIIKGSSLSDRVGIRLSSEAPALFQFDLKSGFLQFFL
APKF
3D structure
PDB6e49 Role of the Pif1-PCNA Complex in Pol delta-Dependent Strand Displacement DNA Synthesis and Break-Induced Replication.
ChainC
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C R44 L131 F249 R44 L131 F249
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0030337 DNA polymerase processivity factor activity
GO:0042802 identical protein binding
Biological Process
GO:0000278 mitotic cell cycle
GO:0000710 meiotic mismatch repair
GO:0006260 DNA replication
GO:0006272 leading strand elongation
GO:0006273 lagging strand elongation
GO:0006275 regulation of DNA replication
GO:0006281 DNA repair
GO:0006289 nucleotide-excision repair
GO:0006298 mismatch repair
GO:0006301 postreplication repair
GO:0007064 mitotic sister chromatid cohesion
GO:0019985 translesion synthesis
GO:0030466 silent mating-type cassette heterochromatin formation
GO:0031509 subtelomeric heterochromatin formation
GO:0034087 establishment of mitotic sister chromatid cohesion
GO:0035753 maintenance of DNA trinucleotide repeats
GO:0045739 positive regulation of DNA repair
GO:0045740 positive regulation of DNA replication
GO:0051054 positive regulation of DNA metabolic process
GO:0070987 error-free translesion synthesis
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0005634 nucleus
GO:0005657 replication fork
GO:0043626 PCNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6e49, PDBe:6e49, PDBj:6e49
PDBsum6e49
PubMed29141206
UniProtP15873|PCNA_YEAST Proliferating cell nuclear antigen (Gene Name=POL30)

[Back to BioLiP]