Structure of PDB 6dnh Chain C

Receptor sequence
>6dnhC (length=117) Species: 9606 (Homo sapiens) [Search protein sequence]
GMQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAAC
GKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFY
SKFGECSNKECPFLHID
3D structure
PDB6dnh Molecular basis for the recognition of the human AAUAAA polyadenylation signal.
ChainC
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C C68 K69 H70 C76 K77 K78 F84 Y97 F98 S106 N107 F112 C69 K70 H71 C77 K78 K79 F85 Y98 F99 S107 N108 F113
BS02 ZN C C49 H59 C50 H60
BS03 ZN C C82 H86 C83 H87
BS04 ZN C C96 C105 C110 H114 C97 C106 C111 H115
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0046872 metal ion binding
GO:1990837 sequence-specific double-stranded DNA binding
Biological Process
GO:0006397 mRNA processing
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex
GO:0043231 intracellular membrane-bounded organelle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6dnh, PDBe:6dnh, PDBj:6dnh
PDBsum6dnh
PubMed29208711
UniProtO95639|CPSF4_HUMAN Cleavage and polyadenylation specificity factor subunit 4 (Gene Name=CPSF4)

[Back to BioLiP]