Structure of PDB 6d6r Chain C

Receptor sequence

>6d6rC (length=265) Species: 9606 (Homo sapiens) [Search protein sequence]

EPLEYYRRFLKENCRPDGRELGEFRTTTVNIGSISTADGSALVKLGNTTV
ICGVKAEFAAPSTDAPDKGYVVPNVDLPPLCSSRFRSGPPGEEAQVASQF
IADVIENSQIIQKEDLCISPGKLVWVLYCDLICLDYDGNILDACTFALLA
ALKNVQLPEVTINEETALAEVNLKKKSYLNIRTHPVATSFAVFDDTLLIV
DPTGEEEHLATGTLTIVMDEEGKLCCLHKPGGSGLTGAKLQDCMSRAVTR
HKEVKKLMDEVIKSM

3D structure

PDB

6d6r Helicase-Dependent RNA Decay Illuminated by a Cryo-EM Structure of a Human Nuclear RNA Exosome-MTR4 Complex.

Chain

Resolution

3.45 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	S41 L50	S33 L42

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0004532	RNA exonuclease activity
GO:0005515	protein binding
GO:0035925	mRNA 3'-UTR AU-rich region binding
GO:0042802	identical protein binding

	Biological Process
GO:0000288	nuclear-transcribed mRNA catabolic process, deadenylation-dependent decay
GO:0000467	exonucleolytic trimming to generate mature 3'-end of 5.8S rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0000956	nuclear-transcribed mRNA catabolic process
GO:0006364	rRNA processing
GO:0006396	RNA processing
GO:0006401	RNA catabolic process
GO:0034473	U1 snRNA 3'-end processing
GO:0034475	U4 snRNA 3'-end processing
GO:0034476	U5 snRNA 3'-end processing
GO:0071028	nuclear mRNA surveillance
GO:0071035	nuclear polyadenylation-dependent rRNA catabolic process
GO:0071038	TRAMP-dependent tRNA surveillance pathway

	Cellular Component
GO:0000176	nuclear exosome (RNase complex)
GO:0000177	cytoplasmic exosome (RNase complex)
GO:0000178	exosome (RNase complex)
GO:0001650	fibrillar center
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005694	chromosome
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0043231	intracellular membrane-bounded organelle
GO:0101019	nucleolar exosome (RNase complex)
GO:1902494	catalytic complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6d6r, PDBe:6d6r, PDBj:6d6r
PDBsum	6d6r
PubMed	29906447
UniProt	Q96B26\|EXOS8_HUMAN Exosome complex component RRP43 (Gene Name=EXOSC8)

[Back to BioLiP]